PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 328aa    MW: 36769.9 Da    PI: 7.1249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603380.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l++ ++ +G g+W++++++ g+ R++k+c++rw +yl
   XP_013603380.1 14 KGLWSPDEDEKLLNHITHHGHGCWSSVPKHAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.77.4e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l+v++++ lG++ W+ Ia++++ gRt++++k+ w++
   XP_013603380.1  67 RGAFSQDEENLIVELHAVLGNR-WSQIAAKLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-26764IPR009057Homeodomain-like
PROSITE profilePS5129424.585965IPR017930Myb domain
SuperFamilySSF466892.64E-2812108IPR009057Homeodomain-like
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
PfamPF002493.0E-151461IPR001005SANT/Myb domain
CDDcd001671.38E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2465117IPR009057Homeodomain-like
SMARTSM007176.0E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.82166116IPR017930Myb domain
PfamPF002492.5E-1367110IPR001005SANT/Myb domain
CDDcd001671.09E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRHSGCYKQ KLRKGLWSPD EDEKLLNHIT HHGHGCWSSV PKHAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEENLIVE LHAVLGNRWS QIAAKLPGRT DNEIKNLWNS NIKKKLKQRG  120
IDPNTHKPIS EVDREKPTTS SNDHMSLSSS SATNQDFFHV RPSDFSDYFN SNLGLSVDSS  180
LCSMFPVQFS TGNMVGSVFQ THSCVKPSIS LPPDNSSSTD QAAPNWEFQT NNTSSFTDNG  240
GFTWSVSNLY PSLVRPNHNF EDLKWSEYVN TPISLPVFVK SEADYLANVS SLADPWSQSQ  300
NESLNTPEAS DVFCKDLQPM AVSFGQSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667411e-156KC966741.1 Brassica napus MYB transcription factor 61 (MYB61.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013714099.10.0PREDICTED: transcription factor MYB86-like
RefseqXP_013603380.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A0D3DYB00.0A0A0D3DYB0_BRAOL; Uncharacterized protein
STRINGBra031669.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-169myb domain protein 61